SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YR37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YR37
Domain Number 1 Region: 246-364
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-17
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 70-161,198-228
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000011
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YR37
Sequence length 655
Comment (tr|M3YR37|M3YR37_MUSPF) Pleckstrin homology domain containing N1 {ECO:0000313|Ensembl:ENSMPUP00000013796} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLEKHN1 OC=Mustelinae; Mustela.
Sequence
MGNNHCVPQAPRRLRASFSRKPSLKGNREDGARKLAGLLGTEAGPDLDTTADKIFYYIPG
PDLRGLESQPENLEQPFLSVFKKGRRRVPVRDLGKVVHYAKVQLRFQHSQDVSDCYLELF
HSYLYFQARGSKGLAFQGLLPLMELSVCPLEGSREHAFQITGVWGAWTVGRGYPEPAGGQ
WSRMVPAGPAHSPPLPPGPLPAPLHVLCPSQAELGHWLYHLEKQIALVRGPQLCHSVSLQ
GSPEGELPWTLQRRLIRLRAASGHRTAGSAVCASRVKLQHLPSQEQQDRLLVLYPSSLAI
FSEEAEGLCFKGELPLSTIHVNLEEKEKQIRSFLIEGPLINTIRVLCASYEDYSHWLLCL
QTISPRAGGAPSAGLPGLWGSTQVTGGGRGSLSSDGRTSWDSGCPAPPSTHTSHSLPESS
VPPTTGCPARPVPDQADPGRTSTRRQRAELRRSSSSRSPRSEARTEEPSLATSLYLDLTK
LSRQSLEDNPEAPDHSLKTPHSPLYADPYTPPATSYHKITDVQGLDEFLSAAQSSLGPES
SSPFPSVPVSVPVSGPSSGLSGPHLLSKKGALQPRASQRHRGSVKGQGPLPPDSPQHVSS
STHPCREVSPDPLPPPSGGHPPKSYGNFRDNASSPSHKRWPRGGPEPGGGLVQWI
Download sequence
Identical sequences M3YR37
ENSMPUP00000013796 ENSMPUP00000013796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]