SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YR69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YR69
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily DEATH domain 1.88e-36
Family DEATH effector domain, DED 0.000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YR69
Sequence length 131
Comment (tr|M3YR69|M3YR69_MUSPF) Proliferation and apoptosis adaptor protein 15 {ECO:0000313|Ensembl:ENSMPUP00000013828} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PEA15 OC=Mustelinae; Mustela.
Sequence
VMAEYGTLLQDLTDNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDN
LSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEE
IIKLAPPPKKA
Download sequence
Identical sequences M3YR69
ENSMPUP00000013828 ENSMPUP00000013828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]