SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YS66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YS66
Domain Number 1 Region: 740-948
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000103
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 
Domain Number 2 Region: 245-329
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000016
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 3 Region: 1084-1240
Classification Level Classification E-value
Superfamily TPR-like 0.00000000237
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 4 Region: 977-1133
Classification Level Classification E-value
Superfamily TPR-like 0.0000000175
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 
Domain Number 5 Region: 191-251
Classification Level Classification E-value
Superfamily SH3-domain 0.0000015
Family SH3-domain 0.0066
Further Details:      
 
Weak hits

Sequence:  M3YS66
Domain Number - Region: 527-662
Classification Level Classification E-value
Superfamily TPR-like 0.000522
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YS66
Sequence length 1289
Comment (tr|M3YS66|M3YS66_MUSPF) SH3 domain and tetratricopeptide repeats 2 {ECO:0000313|Ensembl:ENSMPUP00000014176} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SH3TC2 OC=Mustelinae; Mustela.
Sequence
MGGCFCIPGEPSLSWGPGKETPSKDPTVSSEFIASSEDKERCCLPQNMNPDLTLSFSVKS
RSQRCVNGLLQEAARRRLWALENEDQEVRALFQDLSARLVGIQSQRAQFLITFKTMEEIW
KFSTYLNLGYVSACLEHLLFDHKYWLSCRLVEDTEIQVSVDEKHLETIYLGLLIQEGHFF
CRAMCSVAPPAEKEGEYLTLCKKELISVKITDNESEWEGVSLVTGQRGLVPLSALEPLPL
PFHQWFLKNYPGSCGLSRKRDWTGSYQIGRGKCKAWKEYEREEKDELNFRRGESIEIIGF
VIPGLQWFIGKSTRSGEVGFVPTRNIDPESYSPMNKSSAFFSDEERCSLWVLGSDRKAEC
ASFLHKLAHTDIASVYRLSGFESIQNLPNDLSASQPEGFKEARPGRAWEEHQAVGSRQSS
SSEDSSLEEELLSAASDSYHLPEPDDLDDPELLVDLNTGQEEEEAENFAPMLAFLDHEGY
ADHFKSLYDFSFSFLTSSFYSFSEEDELVAYLEASRKWAKRGRRTWAHARLCFLLGRLSV
RKVKLSQARVYFEEAMYILDGTFEDLSLVAALYTNLAAIYLRQRLRHRGSALMEKAGALL
ACLPDRESSTKNELDVVAYVLRQGIVTGSCPLEARACFLAIRLLLSLGRHEEVLPFAERL
QLLSGHPPDLEATATVLSFLYDKKYLPHLTVASVQERGTQSGQGMSLPIWQVYLVLQNTT
KLLGVPSSSWGEISALACPALRQALAACEGQASWSTQRALCLILSKVYLQHRSPDGAIHY
LRQALVLGQLLSEQEAFESSLCLAWAYLLASQAKKALDILEPLLYSQKETDSITQKGVVH
NLLGLALQGEGRVNRAAKSYLRALNRAQEMGNVRNEAVTLANLGHLTLKSWAEQPAKDYF
LQAIRLYSELQTSMETDMELVQVLLWLAQVLVHGRQLASGRLCYEMALLFGLRHRHLKSQ
LQVTKSLCHFYSSVCPNPKACITYHEHWLTLAQQLRDREMEGRLLESLGQLYRNLNTARS
LRKSLTCIKESLRIFIDLGEKDKAAEAWLGAGRLHYLMQEDELVELYLQAAIQKALKSEE
PSLALKLYEEAGDVFFNGTRHRHCAVEYYRAGAIPLARRMKAMRTELRVFNKLTELQISL
EGYEKALEFATLAARLSTVIGDQKQELVAFHRLATVYYSLHMYEMAEDCYLKTLSLCSPW
LQSPKEALYYVKVYYRLGRLTFYQLKDAHDATEYFQLALAAAVLLGDEELQDSIRSRLDH
ICRSPLWHSSPSGRSSERARWLSGGGLAL
Download sequence
Identical sequences M3YS66
ENSMPUP00000014176 ENSMPUP00000014176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]