SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YSA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YSA6
Domain Number 1 Region: 271-382
Classification Level Classification E-value
Superfamily PX domain 3.4e-29
Family PX domain 0.001
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-16
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YSA6
Sequence length 624
Comment (tr|M3YSA6|M3YSA6_MUSPF) Sorting nexin {ECO:0000256|PIRNR:PIRNR027744} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SNX18 OC=Mustelinae; Mustela.
Sequence
MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIR
APEPGPAGDGGPGAPARYANVPPGGFDPLPAAPPASFKPPPDAFQPLLQPQQAPPPSTFQ
PPAAGYPYGGGALQPSPQQLYGGGYQASQGSDDDWDDEWDDSSTVADEPGALGSSAYPDL
DGSSSAGGAASRYLLSTRSDLSLGSRGGSAPPQHHPSGAKSSATVSRNLNRFSTFVKSGG
EAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKL
VPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWM
NHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD
LQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFEL
DQQAFSAGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQK
GALTKVKESRRHVEEGKMELQKADGIQDRCNTISFATLAEIHHFHQIRVRDFKSQMQHFL
QQQIIFFQKVTQKLEEALHKYDSV
Download sequence
Identical sequences M3YSA6
ENSMPUP00000014216 ENSMPUP00000014216 XP_004737947.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]