SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YSB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YSB1
Domain Number 1 Region: 277-374
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-25
Family PDZ domain 0.008
Further Details:      
 
Weak hits

Sequence:  M3YSB1
Domain Number - Region: 86-194
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00209
Family Myosin rod fragments 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YSB1
Sequence length 463
Comment (tr|M3YSB1|M3YSB1_MUSPF) Golgi associated PDZ and coiled-coil motif containing {ECO:0000313|Ensembl:ENSMPUP00000014221} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GOPC OC=Mustelinae; Mustela.
Sequence
MSAGGPCPAGAGGGPGGASCAVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQ
ADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLKSELTETQAEKVVLEKEV
HDQLLQLHSIQLQLHAKTGQSVDSGTIKAKLSVPSVEELERELEANKKEKMKEAQLEAEV
KLLRRENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQ
LEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGL
GISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGSNPGASCKDTSGEIKVLQ
GFNKKAVADGHENGDLGTSSETPVEDSASKLDDLHSLYHKKSY
Download sequence
Identical sequences M3YSB1
ENSMPUP00000014221 ENSMPUP00000014221 XP_004740138.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]