SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YSW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YSW6
Domain Number 1 Region: 47-161
Classification Level Classification E-value
Superfamily FKBP-like 1.31e-34
Family FKBP immunophilin/proline isomerase 0.000000511
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000935
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YSW6
Sequence length 162
Comment (tr|M3YSW6|M3YSW6_MUSPF) Peptidyl-prolyl cis-trans isomerase {ECO:0000256|RuleBase:RU363014} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PIN1 OC=Mustelinae; Mustela.
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGSKNGQGEPTRVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT
Download sequence
Identical sequences G9KGP8 M3YSW6
ENSMPUP00000014426 ENSMPUP00000014426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]