SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YT67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YT67
Domain Number 1 Region: 367-445
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-24
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 134-169
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000157
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  M3YT67
Domain Number - Region: 187-280
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00115
Family Myosin rod fragments 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YT67
Sequence length 495
Comment (tr|M3YT67|M3YT67_MUSPF) Keratin 10 {ECO:0000313|Ensembl:ENSMPUP00000014527} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KRT10 OC=Mustelinae; Mustela.
Sequence
MSVRYSSSKQYSSSRSGGGGGGGGGSSFRISSSKGSIGGGFSSGGFSGGSFSRGSSSGGC
FGGSSGGYGGLGGGFGGGNFGGGYGSSSFGGGCGGGSFGGGSFGGGGFGGGGFGGGSFGG
YGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSSQ
REPRDYSKYYQTIEELKNQILSLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVDA
DINGLRRVLDELTLAKADLEMQIESLTEELAYLKKNHEEEMKDLHNVSTGDVNVEMNAAP
GVDLTELLNNMRNQYEQLAEQNRKDAEAWFNEKSKELTTEINSNIEQMSSHKSEITELRR
TVQGLEIELQSQLALKQSLESSLAETEGRYCVQLSQIQAQISSLEEQLQQIRAETECQNA
EYQQLLDIKIRLENEIQTYRSLLEGEGSSSGGGGYGGGRGGGSSGGGYGGGSSGGGHKSS
SSGSVGESSSKGPRY
Download sequence
Identical sequences M3YT67
ENSMPUP00000014527 ENSMPUP00000014527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]