SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YTU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YTU8
Domain Number - Region: 475-565
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0255
Family Di-heme elbow motif 0.063
Further Details:      
 
Domain Number - Region: 610-637
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0399
Family A20-like zinc finger 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YTU8
Sequence length 790
Comment (tr|M3YTU8|M3YTU8_MUSPF) TNF alpha induced protein 3 {ECO:0000313|Ensembl:ENSMPUP00000014758} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TNFAIP3 OC=Mustelinae; Mustela.
Sequence
MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKSMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAASQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWTDEWDSLIKMASTDTP
VARGGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIILGYDSQHFVPLVTLKDSGPEIRAVPLVNRERGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENN
EQERREIHAQNPLEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKTQSKPSK
LHSKPGPEVLPGMALGPSRGEAYEPMGWSPEEPAGGPRSAPPTAPSLFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHNARQLGAGHPSDSTRHLDPGKCRACLQDVTRTFNGICSTCF
KRTTAEPSSGLSSSVPPSCHQRSKSDPSQLVQSLSTHSCHRAGTEAPSGCLSQATRTPGD
RTGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKHFVPASTKASPTAPRFQNAVPCLGR
ECGTLGSTVFEGYCQKCFIEAQSQRFHEAKRTEEQLRTSQRRDATRSTTSASRPKCARAS
CKNILACRSEELCMECQHLGQRVGAGAHRGEPVPEEAPKQRCRAPACDHFGNAKCSGYCN
ECFQFKQLYG
Download sequence
Identical sequences M3YTU8
ENSMPUP00000014758 ENSMPUP00000014758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]