SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YU03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YU03
Domain Number 1 Region: 335-381
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-17
Family TRASH domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YU03
Sequence length 1557
Comment (tr|M3YU03|M3YU03_MUSPF) Zinc finger MYM-type containing 4 {ECO:0000313|Ensembl:ENSMPUP00000014813} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZMYM4 OC=Mustelinae; Mustela.
Sequence
MRLLSFSLQGLFHGCALQFKFEQKTGAVFDEIVENCGGIMDTEMSEDIDHNLTPTLDSMS
YGMPNQTGSENSLLDEDDYFLNSGDLAGIPVVGSDNEDEQDFSSKDNLVSSIHTDDSLEV
ERRVTQHESDNENEIQIQNKLKKDFPKQFDQVSVFKSIRKDFSLVRENSKETFSGKEKNR
DLTYHEREKRLDKPHKELDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFASK
ESIGSELGNSFASNIRIKEEPLDDEYDKAMAPQQGLLDKIKDEPDNAQEYSHGQQQKTQE
GELKISAVFSVSGSPLAPQLTTGFQPSLASSGMNKMLPSVPATAVRVSCSGCKKILQKGQ
TAYQRKGSTQLFCSTLCLTGYTVPPARPPPPPTKKTCSSCSKDILNPKDVISAQFENSTT
SKDFCSQSCLSTYELKRKPVVTINTNSISTKCSMCQKNAVIRHEVNYQNVVHKLCSDACF
SKFRSANNLTMNCCENCGGYCYSGSGQCHMLQIEGQSKKFCSSACVTAYKQKSAKITPCA
LCKSLRSSAEMIENTNSLGKTELFCSVNCLSAYRVKMVTSAGVQVQCNSCKTSAIPQYHL
AMSDGSIRNFCSYSCVVAFQNLFNKPAGMNSSVVPLSQGQVIVSIPTGSTVSAGAGSTSA
VSPTSISSSAAAGLQRLAAQSQHVGFARSVVKLKCQHCNRLFATKPELLDYKGKMFQFCG
KNCSDEYKKINNVMAMCEYCKIEKIVKETVRFSGADKSFCSEGCKLLYKHDLAKRWGNHC
KMCSYCLQTSPKLVQNNLGGKVEEFCCEECMSKYTVLFYQMAKCDGCKRQGKLSESLKWR
GEMKHFCNLLCILMFCNQQSMCDPPSQNNAASISMVPAASAGPPSLRKDSTPVIANVVSL
ASAPAAQPTVNSNSVLQGAVPTVTAKIIGDASTQTDALKLPPSQPPRLLKNKALLCKPIT
QTKATSCKPHTQNKECQTEDTPSQPQIIVVPVPVPVFVPIPLHLYTQYAPVPFGIPVPMP
VPMLIPSSMDNEDKVTESIEDIKEKLPSHPFEADLLEMAEMIAEDEEKEKTLSQGGSQTS
EQELFLDTKIFEKDQGSTYSGDLESEAVSTPHSWEEELNHYALKSNAVQDADSDLKPLSK
GETEQDLEADFPSESFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSIVAVEPRSLI
QGAFQGCSVSGMTLKYMYGVNAWKNWVQWKNAKEEQGDLKCGGIEHAASSPCSDSLGSSQ
DHALSQESSDPSCRVRSIKLKEDILSCTFAELSLGLCQFIQEVRRPNGEKYDPDSILYLC
LGIQQYLFENGRIDNIFTEPYSRFMIELTKLLKIWEPTILPNGYMFSRIEEEHLWECKQL
GAYSPIVLLNTLLFFNTKYFQLKNVTEHLKLSFAHVMRRTRTLKYSTKMTYLRFFPPLQK
QESEPDKLTVGKRKRNEDDEVPVGVEMAENTDNPLRCPVRLYEFYLSKCSESVKQRNDVF
YLQPERSCVPNSPMWYSTFPIDPGTLDTMLTRILMVREVHEELAKAKSEDSDVELSD
Download sequence
Identical sequences M3YU03
ENSMPUP00000014813 ENSMPUP00000014813 XP_004740882.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]