SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YU20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YU20
Domain Number 1 Region: 79-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-16
Family TRASH domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YU20
Sequence length 733
Comment (tr|M3YU20|M3YU20_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000014830} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MKEPLDGECGKAMAPQQGLLDKIKEEPDNAQEYGHAPKPKTQESELKISAVFSVGDSPLA
QQLTPGFQFSLASSGPNISLPLVPAVAIQVFCSGCKKMLHKGQTAYHKTGSTQLFCSTRC
ITGYSSSVCIPPPPKKTCTNCSKDILNPKDVITTRFENSSPSKDFCSQSCLSSYELKKKP
VVTIYTNSISTKCSICQKNADIRFEVKYQNVVHGLCSDACFSKFHSANNLTMNCCENCGS
YCYSSSGPCQSQKVFSSTSVTAYKQNSAQTPPYALGKSLRPSAEMIETTNDSGKTELFCS
INCLSAYRVKTVISSDQGVQVSCHSCKTSAIPQYHLAMSNGTIYSFCSSSCVVAFQNVFN
KPKGTNSSAVPPSQGQVVVSPPSGSAVSAAGGNASASSGSSPTGSISSSASGTAGFRPLA
APSQQVAVARTLVKLKCQHCSHLFATKPELLFYKGKMFLFCGKTCSDEYKKKNKVMAMCD
YCKLQKIIKETVRFSGVDKPFCSEVCKFLSARDFGERWGNYCKMCSYCSQTSPNLVENRL
EGKLEEFCCEDCMSKFTVLFYQNMFGSCEGRANMVKISSLIDYRLNHICHVPIFYVIIYS
LRLVGLVVEFSFYNMVNIYKAASASVELSSARKNTTPVITSVVSLAKIPPTQPTGNTNSV
LKGTITKEAAKIIEDGIMQTDALKLLSSQSSRLLKNKAVLCKPVTQTKATSCKPHTQHKE
CQTDFPMPNEKHD
Download sequence
Identical sequences M3YU20
ENSMPUP00000014830 ENSMPUP00000014830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]