SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YUE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YUE0
Domain Number 1 Region: 206-281
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 31-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000207
Family LASP-1 0.0028
Further Details:      
 
Weak hits

Sequence:  M3YUE0
Domain Number - Region: 61-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000298
Family LIM domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YUE0
Sequence length 282
Comment (tr|M3YUE0|M3YUE0_MUSPF) LIM and SH3 protein 1 {ECO:0000313|Ensembl:ENSMPUP00000014950} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LASP1 OC=Mustelinae; Mustela.
Sequence
HPRPPPASSLRGKRTRASSGVPAPTLPGAMNPNCARCGKIVYPTEKVNCLDKFWHKACFH
CETCKMTLNMKNYKGYEKTPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFE
KNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMAPSGGEGMESERRDTQEQQQ
PPHHIPASAPVYQQPQQQPVAQSYGGYKEPAAPVSIPCRAPGGGGKRYRAVYDYSAADED
EVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Download sequence
Identical sequences M3YUE0
ENSMPUP00000014950 ENSMPUP00000014950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]