SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YUZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YUZ9
Domain Number 1 Region: 123-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.98e-119
Family Myotubularin-like phosphatases 0.000000347
Further Details:      
 
Domain Number 2 Region: 17-115
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000148
Family GRAM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YUZ9
Sequence length 540
Comment (tr|M3YUZ9|M3YUZ9_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000015159} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEFLELIRTGRAQVKLLRGPEAPPLRGTLCVTGHHLLLSPGPQGTSDLWLLLLRSVDSIE
KRVSGDSGTITLRCKDLRVLQLDIEGVEATLDIARSIEALSSLESVITSFPFFYRPRGLR
LGDAWHFHPPERYYKRVARETNAWRLSEVNEDFSLCPSYPRAVIVPRAVDDDALARCARF
RQGGRFPVLSYHHAPSGTVLLRSSQPLTGPQKRRCAEDEELLRAVLAGARPGAPGFILDT
RSAQAAKQAGVTVGGTEAKAAYPGWKRLHRPLEKGRPLQESFVRLVEACGDLEKSMDGWL
SQLEACCWLAHVKEALSTACLAAWGMEREEACILVHGAEGMDNTLLVTSLAQIILDPLSR
TMTGFQELVEREWIQAGHPFQLRCAHSAFSHAQPKHEAPTFLLFLDCVWQLGRQFPLSLE
FGEGLLLALFEHAYASPFGTFLCSSEKERCLCEVRTRTHSLWSGLNQPKVRRKLRNPLYI
PNPLAIWPSVEPQSLQLWQGLFLRWIRPPEPSQVAWEKVWQRLASKEKTEDCESTSKPQS
Download sequence
Identical sequences M3YUZ9
ENSMPUP00000015159 ENSMPUP00000015159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]