SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YV55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YV55
Domain Number 1 Region: 557-628
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000316
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 495-562
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000236
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  M3YV55
Domain Number - Region: 467-493
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00176
Family LIM domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YV55
Sequence length 671
Comment (tr|M3YV55|M3YV55_MUSPF) LIM domains containing 1 {ECO:0000313|Ensembl:ENSMPUP00000015215} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LIMD1 OC=Mustelinae; Mustela.
Sequence
MDKYGDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQLLQEETLPRGSRGPVNGGAPMGPQARRDAGVSSKLTVDGAAKPPLAASTVGPGTAPSV
VPGQPSYPPQEQRARTYARSASHSSQDYGSKESLAGWEMSGFRPLGSCEDPSCLTHGDYY
DNLSLASPKWADEPRVSPGIRPGAGSGWPGSPGTDAPLPKPSRDHPLCQPQLSLSSSRSL
ESSQDGAGGRGDEKPTGLWTTSSSPRVSPGLSSPGPENGAMVGPPPPRTSSFLAPLAQSC
PSQGALPRTNSGVGSEVSGLMPKATVDPQVWFQDGPKSYLSSSASSSSPASVDSMPSGAA
PGLGPKPVCTDPGVGPKLSPTSLVHPAMSTPPELSCKEGPPGWSSDGSLGPALLESPSPP
RVRLPCQTLVPGPELGPSAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVFGAGQA
CQAMGNLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGHLIM
DMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGLPIL
PPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRLEQS
PASAALHQPRF
Download sequence
Identical sequences M3YV55
XP_004760877.1.14098 ENSMPUP00000015215 ENSMPUP00000015215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]