SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YV81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YV81
Domain Number 1 Region: 543-755
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.000074
Further Details:      
 
Domain Number 2 Region: 93-364
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.56e-34
Family FCH domain 0.054
Further Details:      
 
Domain Number 3 Region: 483-538
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000959
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YV81
Sequence length 969
Comment (tr|M3YV81|M3YV81_MUSPF) GEM interacting protein {ECO:0000313|Ensembl:ENSMPUP00000015241} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GMIP OC=Mustelinae; Mustela.
Sequence
MDAAEPGLPPAPESRKRYSDIFRSLDNLEISLGNVTLEMLPGDPVLSGDPESDKTPTANE
TSETSIWSRPSTEGPAPLTGEELDLRLIRTTGGVDAALEYAKTWSRYAKELLAWTEKRAS
LELEFAKSIMKIAEAGKVSIHQQNHMPLQYIYTLFLEHDLSLGALAMETVAQQKRDYYQP
LAAKRTEIEKWRKEFKEQWTKEQKRMNDAVQALRRAQLQYVQRSEDLWVRSQASPEDPAP
QASPGPSKQQERRRRSREEAQAKVQEAMALYQMCVREANARQQDLEAAKQRIVSHVRKLV
LQGDEVLRRVTLGLFKLRGAQAERGPRAFSALAECCEPFEPGQRYQEFVRVLQPEAPPPP
PPAFSFQEFVPAAHSSPLDTRKKISCPPPPRLDESASEAGPWEDAGTGWQGTPGRTPGGD
ADSVGGGSESRSLDSPTSSPGSGTRRLVKVSSIGTESSDDFEERDPDLVDGLENGLGSPF
RKWTLSNAAQTHRLRRLRGPAKCRECDAFMVSGTECEECFLTCHKRCLETLLILCGHRRL
PARTPLFGVDFLQLPRDFPEEVPFVITKCTAEIEQRALGVQGIYRVSGSRVRVERLCQAF
ENGRALVDMSGNSPHDVSSVLKRFLQELTDPVVPFHLYDAFISLAKTLHADPGHDPGTPS
PSPEVIRSLKTLLVQLPDSNYSTLRHLVAHLFRVAAQFEENKMSANNLGIVFGPTLLRPP
DGPGTAGAGPVTCLLDSGHQAQLVEFLIVYYEQIFGMDDLPVATEPLPQDPSPAPGPLLN
NNLQPPSSDLAPDPLPPVLASDPDPDPEPHSTLEKHPEATPPEIPTPQSDQRDMVEDTRE
EGGEVSSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTHQLSSLAQVASKLSEETPVAS
VTRGSLRRRGPGPVSSSSPEGSPLRRTALPKHFEITQETARLLSKLHNEAVPKATCCPDP
QPEEVEDHL
Download sequence
Identical sequences M3YV81
ENSMPUP00000015241 XP_004760904.1.14098 ENSMPUP00000015241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]