SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YVC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3YVC9
Domain Number - Region: 418-454
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000998
Family LIM domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YVC9
Sequence length 639
Comment (tr|M3YVC9|M3YVC9_MUSPF) GATA zinc finger domain containing 2A {ECO:0000313|Ensembl:ENSMPUP00000015289} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GATAD2A OC=Mustelinae; Mustela.
Sequence
MHRSHFRMTEEACRTRSQKRALERDPAEDDVESKKIKMERGLLSSDLNTDGDLRVTPEPG
AGPAQGLLRGAEVPTVGRCEGQAGDGPVDMRTSYSDMKSERRAPSPDVIVLSDNEQPASP
RVNGLTKEALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKETT
TQKPTGSAGSAVTTPPPLVRGTQNIPSGKPSLQTSSTRMPGSVIPPPLVRGGQQVSSKLG
PQASSQVVMPPLVRGAQQIHNIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVA
NVPNTSLLVNIPQPSPASLKGTTATSAQANSTPTSVASVVTSADSPASRQAAAKLALRKQ
LEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRMSAAAVLSREP
YMCAQCKTDFTCRWREEKGGAIMCENCMASNQKKALKVEHTSRLKAAFVKALQQEQEIEQ
RLLQQGAAPTQAKAEPAAAPHPALKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGS
TTTPRGVLHTFSQSPKLQNAASATALVSRTGRHSERAVSTGKGNATTNWKKAPLSTGGAL
AFVSPSLAVHKTSSAVDRQREYLLDMIPPRSIPQSATWK
Download sequence
Identical sequences M3YVC9
XP_004760914.1.14098 XP_004760915.1.14098 ENSMPUP00000015289 ENSMPUP00000015289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]