SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YVD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YVD1
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-17
Family PDZ domain 0.0000948
Further Details:      
 
Domain Number 2 Region: 195-249
Classification Level Classification E-value
Superfamily EF-hand 0.0000731
Family Calmodulin-like 0.051
Further Details:      
 
Weak hits

Sequence:  M3YVD1
Domain Number - Region: 261-301
Classification Level Classification E-value
Superfamily BAG domain 0.0863
Family BAG domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YVD1
Sequence length 522
Comment (tr|M3YVD1|M3YVD1_MUSPF) Syntaxin binding protein 4 {ECO:0000313|Ensembl:ENSMPUP00000015291} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=STXBP4 OC=Mustelinae; Mustela.
Sequence
MITVTKETGLGLKILGGINRNEGPLVYIQEIIPGGDCYKDGRLKPGDQLVSINKESMIGV
SFEEAKSIITRAKLRSESVWEITFIRQKSDGSHPGNPSCTSLLQASGEYGPQVSTFSLLP
SPPETLIPKTSSTPQTTDTILPSFRINQMKTGYKKTEQTPITSSGNSPTDMSNTDIAPAW
TDNYGPQGKKISLNPSVRLKAEKLEMALDYLGIQPTKEQHQALRQQVQVDPKGTVSFGDF
VQVARNLFCLQLDEVNVSAREISSILDSQLLPCDSLEADEIERLKRERNDALEEVNMLKE
KLFESERQKKQLAEELQNVKQEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDYEEVIRL
LEAEVTDLKAQLADYSDQNKESVQELKKRITVLDCQLRKSEMARKTFEASTEKLLHFVET
IQELFSDNTSPLSNLSERRAMLASQTSLTPLGRNGRNIPAMLALESKELVKSVRAILDMD
CKFSAIFHFLFFFFFFSNLFNRTKRNFKLDSLILLNVLVCLQ
Download sequence
Identical sequences M3YVD1
ENSMPUP00000015291 ENSMPUP00000015291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]