SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YVF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YVF9
Domain Number 1 Region: 3-40,80-112
Classification Level Classification E-value
Superfamily Chromo domain-like 6.04e-20
Family Chromo barrel domain 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YVF9
Sequence length 351
Comment (tr|M3YVF9|M3YVF9_MUSPF) Mortality factor 4 like 1 {ECO:0000313|Ensembl:ENSMPUP00000015319} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MORF4L1 OC=Mustelinae; Mustela.
Sequence
MRGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKKSAGRPRRSEKALKTREDIV
ALFPVPEGAPSVHHPLLTSSWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGA
APGKKTSGLQQKNVEVKTKKNKQKAPGNGDGGSTSETPPPPRKKRARVDPTVESEETFMN
RVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKEY
AVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIGA
MLAYTPLDEKSLALLLNYLHDFLKYLAKNSAALFSASDYEVAPPEYHRKAV
Download sequence
Identical sequences M3YVF9
ENSMPUP00000015319 ENSMPUP00000015319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]