SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YVJ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YVJ2
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.62e-23
Family APC10-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YVJ2
Sequence length 143
Comment (tr|M3YVJ2|M3YVJ2_MUSPF) Nuclear receptor 2C2 associated protein {ECO:0000313|Ensembl:ENSMPUP00000015352} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NR2C2AP OC=Mustelinae; Mustela.
Sequence
MTHSLVCPETVSRVSSVLNRDTRQFGKKHLFDQNEETCWNSDQGPSQWVILEFPQRIRVS
QLQIQFQGGFSSRRGHLEGSQGSEALSKIVDFYPEDNNSLQTFPVPAAEVDQLKVTLEDA
TDFFGRVVIYHLRVLGERGTNRD
Download sequence
Identical sequences M3YVJ2
ENSMPUP00000015352 ENSMPUP00000015352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]