SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YVL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YVL6
Domain Number 1 Region: 1558-1856
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.18e-74
Family Rap/Ran-GAP 0.00035
Further Details:      
 
Domain Number 2 Region: 138-325,364-694
Classification Level Classification E-value
Superfamily ARM repeat 7.82e-21
Family Armadillo repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YVL6
Sequence length 1906
Comment (tr|M3YVL6|M3YVL6_MUSPF) TSC complex subunit 2 {ECO:0000313|Ensembl:ENSMPUP00000015376} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TSC2 OC=Mustelinae; Mustela.
Sequence
MRMTNFCALHIPAAPAARHVTRSSLRLSARELPGTTTPGKLVRGARALCAAGSADRASGG
GSGLGVGPGWLSFLPAGTARRPVPEAASGAFLSAMAKPTSKDSGLKEKFRNLLGLGTPRP
NPRSAEGKQTEFIITADILRELSVECGINNRIRVIGQICEVAKTKKFEEHAVEALWKAVA
DLLQPERPPEARHAVLALLKAIVQGQGDHLGVLRALFFKVIKDYPSNEDLHERLEVFKAL
TDNGRHITYLEEELAGFVLQWMDIGLSSEFLLVLVNLVKFNSCYLDEYIASMVHMICLLC
VQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFIVTLCRTINVKELCEPCWKLMRNLLGT
HLGHSAIYNMCRIMEDRAYKEDAALLRGAVFFVGMALWGAHRLYSLKNSPTSVLPSFYEA
MTCPNEVVSYEIVLSITRLIKKYRRELQAVTWDILLTIMERLLQQLQSLDSPELRAVVHD
LLTTVEELCDQSEFHGSPERYFELVERCADQRPESSLLNLITYRAQSIHPAKDGWIHNLQ
LLMERFFRNESRSAVRIKVLDVLSFVLLINRQFYEEELISSVVISQLSHVPEDKDPQVRK
LATQLLVDLAEGCHTHHFNSLLDIVEKVMSRSLSPPAELEERDVAAYSASVEDVRTAVLG
LLVILQTKLYSLPASHAMRVYETLVGHIQLHYKHDYTLPIAASIRLQAFDFLLLLRADSL
HRLGLPSKDGAVRFSPYCVCDAMEPERGPEKKASGTLSNPTGPPGPAPTGPAVRLGSLPY
SLLFRVLLQCLKQEADWKVLKLVLGKLPESLRYKVLIFTSPCSVDQLSAALCSMLSGPRT
LERLRGTPEGFSRTDLHLAVVPVLTALISYHNYLDKTRQREMVYCLEQGLIYRCASQCVV
ALAICSVEMPDIIIKALPVLVVKLTHISATASMAVPLLEFLSTLARLPHLYRNFAAEQYA
SVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRCRLPFRKDFVPFITKGLRSNVLLSFDD
TPEKDSFRARSTSLNERPKSLRIARTPKQGLTNSPPVKECKESSAAEAFRCRSISVSEHV
VRRIQTSLTSASLGSADENSMAQADDNLKNLHLELTETCLDMMARYVFSNFTAVPKRSPV
GEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSLLGLDSGELQGGPELSTDAGVHVRQTKE
APAKLESQAGQQVCRGARDRVRSMSGGHGLRVGTLDTPASHFAGGPTSPGAQTAPASKPE
RASAGTQFPAQEKTSLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMP
LQELSNALMAAERFKERRDTALYKSLSVPAAGSAKPPPPPRSNTVASLSSLCQSSCRAQL
HRGVSWADSAVVPEEGSPSEARLPTEPTELEDFEATLGTDRRSGRAEAYSRSSSSSSQEE
RFPAEEPAAGGVPIERAVSSEGARPSAELPFQPCQPLSKSSSSPELQTLQDILGDPGDKT
DVGRLSPEAKTRSQSGILDGAGAAWSAPGEESQGRGPTQPEGPLPSSCPRSPSGLRPRGY
TISDSAPSRRGKRVERDAFKSRTGASNTEKVPGINPSFVFLQLYHSPFFGDESNKPILLP
NESFERSVQLLDQIPSYDTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGLGKLIE
LKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQAVFHIATLMPTKDVDKHRCDKKRHLGN
DFVSIVYNDSGEDFKLGTIRGQFNFVHVIITPLDYECNLVSLQCRKDMEGLVDTSVAKIV
SDRNLPFVARQMALHANMASQVHHSRSNPTDIYPSKWIARLRHIKRLRHRIQEEAQYSSP
SLPLLQTHTPGHGKAPAPAPAEPVPAYETGQRKRLISAVDDFTEFV
Download sequence
Identical sequences M3YVL6
XP_012910688.1.14098 ENSMPUP00000015376 ENSMPUP00000015376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]