SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YVM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YVM4
Domain Number 1 Region: 144-232
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-25
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 2 Region: 6-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-25
Family PDZ domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YVM4
Sequence length 337
Comment (tr|M3YVM4|M3YVM4_MUSPF) Na(+)/H(+) exchange regulatory cofactor NHE-RF {ECO:0000256|PIRNR:PIRNR037866} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SLC9A3R2 OC=Mustelinae; Mustela.
Sequence
LVMPDPRGPGMCRXVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVVDKETDEELRRRQLTCTEEMAHRGLPPAHDPWE
PKPDWARASSLGSEAGQKDVGGPPRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAAHSGLRAQDRLIEVNGHNIEGLRHAEVVASIKAREDEARLLVVDPETDEYFKRLR
VTPTEEHLEGPLPSPVTNGTSPVQLNGGSACSSRSDLPGLDKDTEDSSTWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
Download sequence
Identical sequences M3YVM4
ENSMPUP00000015384 ENSMPUP00000015384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]