SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YW51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YW51
Domain Number 1 Region: 294-403
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.32e-23
Family PWWP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YW51
Sequence length 624
Comment (tr|M3YW51|M3YW51_MUSPF) Zinc finger CW-type and PWWP domain containing 1 {ECO:0000313|Ensembl:ENSMPUP00000015561} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZCWPW1 OC=Mustelinae; Mustela.
Sequence
MTSLQSKEACGKGPKKTFAPPAPKLHSLMCYSPKPPKEDTVGISSPKARLEKKEEKATTE
NGPSSGQENKGKPQDKQVEKKEKERSSLTSAEFEEIVQIVLRKSLQECLETSCAQPIRCT
QLDKEPGIASSTENDKADGERVMAPHILEISATKEAGVSSVIKMSKPGQPDPVPSEKKFN
RTSLSKRKKGAQDDKMEKAQNTHEQRQKDQLKKPVQDDSQTRNQQKGEGSGFGQCLVWVQ
CSSPNCEKWRRLCGNVDPSVLPDNWSCDQNTDSRYNRCDIPEECWTGRESDVAYASYIPG
SIIWAKQYGYPWWPGMVESDPDLGEYFLFASHLDSLPSKYHVTFFGETVSRAWIPVNMLK
NFQELSLELARMKKCRNKDCNQKLGAALTMAQEAEQISIQERVNLFGFRSRYNGSDRSGE
GKDLRLSGANSPDSCLGKEEEDSELEAEELEEEEEKKDPTLPSPKPAKIQTKKPKARGLA
NGRDGTLQKKTMKRSLGNESAAPPVSIIGRKEGHGKSEPDQPGLKKKFKAPQSKASGTSL
SEDQEARMVPKDLTPPAHRGACPVVGKEGRKCPQEAGSVTPDDDASSDLDLEQFLEDVGT
EPEQLEEPWCGDAAGDFTLAFFEE
Download sequence
Identical sequences M3YW51
XP_012916465.1.14098 ENSMPUP00000015561 ENSMPUP00000015561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]