SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YWE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YWE3
Domain Number 1 Region: 429-573
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 2 Region: 254-364
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000027
Family PDZ domain 0.025
Further Details:      
 
Domain Number 3 Region: 96-153
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000628
Family SAM (sterile alpha motif) domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YWE3
Sequence length 791
Comment (tr|M3YWE3|M3YWE3_MUSPF) Connector enhancer of kinase suppressor of Ras 1 {ECO:0000313|Ensembl:ENSMPUP00000015653} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CNKSR1 OC=Mustelinae; Mustela.
Sequence
MLGETVPTSFGPGLGEWMASPSIKELVREDLPLTLTSKPLPPAPALGGGGGGCFCYFCLQ
GLGCLFPTWSSFGTYSLAFPRGSCILAGDPKWNPGLDDSLQHYCFEDWELPGKYLLQLCP
RSLEALTVWPLGHQELILEGVEQLRALSSGLQTENLQSLTEGLLQRTYAFQSLVQGHLEG
CAKPPADVLSAAVELVHEARTLLFWLNRYLFSHLNDFSACQKIGELCGELGQALQEDSPA
AERESQVLRICSHVAGICHHILRCSPQELLEQRALLERVQLDDPLGLEIHTTGNCLHFVS
RVGPQVAADSPLQILPGDEIVQVNEQVVVGWPHKNVLRELLREPAGVSLVLKKVPVPKTP
PQTLAQTPGSAPLSSPLLAFTPLSPRAPSEDVFAFDLTSDPSPAPSPTWTDSTSLDLESR
PIHPAPLATYPAGVAETQEAPEQPDTSPVSGRKKSKGVATRLSRRRVSCRELGQPDCDGW
LLLRKVPGGFMGPRWRRCWFVLKRHTLYWYRQPQDEKAEGLINVSNYSLESGQDQKKKYV
FQLTHDMYKPFIFAADTLEDLSMWVRHLITCISKYQSPGRASLPREEDCYSETEAEDPDD
EAGSRSASPSPAQVWSPLHGDTSPAATPTQGSPRTSFGPPSDSSEGALEGMVQGLRQGGV
SLLGQLQPFTHEQWRSSFMRRNRDPQLNERVHRVRALQSTLKAKLQELQALEEVLGDPEL
TGEKFRQWKEQNQELYSEGLGGWGVVQPEGPSQVPSSDSREQSSHPLPSDPEEQSHLCPL
TPESNLRPPDL
Download sequence
Identical sequences M3YWE3
ENSMPUP00000015653 ENSMPUP00000015653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]