SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YWW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YWW9
Domain Number 1 Region: 32-165
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-40
Family Pleckstrin-homology domain (PH domain) 0.000000813
Further Details:      
 
Domain Number 2 Region: 245-356
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-24
Family SH2 domain 0.00000654
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YWW9
Sequence length 380
Comment (tr|M3YWW9|M3YWW9_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000015829} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MWHRRASPEPDAGATPRAAEPPAEPRDKWTRRLRLSRTLAAKVELVDIQREGALRFMVAD
DAAAGSGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLE
MPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTELSCARGGCLAS
RVASCSCELLTDAGDLPRPPETTAAVVTAPHSRARDGVGESLAHVPLETFLETLESPGGG
GRDSSTTGEEGAEPEPEAEPELELSDYPWFHGTLSRVRAAQLVLAGGPRSHGLFVIRQSE
TRPGEYVLTFNFQGKAKHLRLSLNSHGQCHVQHLWFQSVLDMLRHFHTHPIPLESGGSAD
ITLRSYVRAQGPPPAAGPSP
Download sequence
Identical sequences M3YWW9
ENSMPUP00000015829 ENSMPUP00000015829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]