SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YX96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YX96
Domain Number 1 Region: 20-112
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000213
Family delta-Endotoxin, C-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YX96
Sequence length 569
Comment (tr|M3YX96|M3YX96_MUSPF) NPR3 like, GATOR1 complex subunit {ECO:0000313|Ensembl:ENSMPUP00000015956} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NPRL3 OC=Mustelinae; Mustela.
Sequence
MGDNTSPISVILVSSGSRGNKLLFRYPFQRSQEHPASQTNKPRSRYAVTSTGDHAEDQDG
DSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHGLGQVSKTDPSPKREAPT
MILFNVVFALRANADPSVINCLHTLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAM
ADASDGPQSPFHHILPKCKLARDLKEAYDSLCTSGVVRLHVNSWLEVSFCLPHKIHYAAS
SLIPPEAIERSLKAIRPYHALLLLSDEKSLLGELPLDCSPALVRVIKTTSAVKNLQQLAQ
DADLALLQVFQLAAHLVYWGKAIIIYPLCENNVYMLSPNASVCLYSPLAEQFSRQFPAHD
LPSVLAKFSLPVSLSEFRNPLAPPVQETQLIQMVVWMLQHRLLVQLHTYVCLMASPSEEE
PHAREDEVPFTARVGGRSLSTPNALSFGSPTSSDDMTLTSPSMDNSSAELLPGGDSPLNK
RMTENLLASLSEHERAAILSVPAAQNPEDLRMFARLLHYFRGRHHLEEIMYNENTRRSQL
LTLFDKFRSVLVVTAHEDPVIAVFQALLP
Download sequence
Identical sequences M3YX96
ENSMPUP00000015956 ENSMPUP00000015956 XP_004750994.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]