SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXG6
Domain Number 1 Region: 136-266
Classification Level Classification E-value
Superfamily GAT-like domain 9.02e-45
Family Phosphoinositide-binding clathrin adaptor, domain 2 0.00000167
Further Details:      
 
Domain Number 2 Region: 5-131
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.36e-36
Family Phosphoinositide-binding clathrin adaptor, N-terminal domain 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YXG6
Sequence length 443
Comment (tr|M3YXG6|M3YXG6_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000016026} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MGSSASKAALGATTDEPMEPKAKHLADLIQYINGTNMSVDHLADVLSEKTGNSSWVVVFK
ALVTVHHLMVHGNERFIQHLASRNSLFTLHNFLDKSVIEGYTMSTFIRRYSRYLNEKSLA
YRLIASDITKTKRGTDGTMRTMDTKRLLNTLPVIQTQFDALLNFNANPDELTNGIIHAAF
MLLFKDSLRLFAAYNEGILNLLDKYFDMRKNQCKESLDIYIKFLERTAKLAQFLKVAEQV
GIDQNDIPYLTQAPHSLLEALKQHLASLEEKNDSWSPYSLQHALIPSIPNNPVVNASASG
AWFAAHKSVEARQQHGKITAKNLDGSLVNLVGNLNLGESPVNRLDMEWPQPSEMEIAGGM
KWQLNTYTCTSTLWKHISIPPVPHMVLPPVGYPVTSQQVPMYRMVHTPKGALFLMAPQPM
IHGQPGSRTSNSAPSTRNNTQSM
Download sequence
Identical sequences M3YXG6
ENSMPUP00000016026 ENSMPUP00000016026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]