SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXJ6
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily PX domain 7.59e-27
Family PX domain 0.00000114
Further Details:      
 
Domain Number 2 Region: 218-332
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-25
Family SH3-domain 0.00000109
Further Details:      
 
Domain Number 3 Region: 147-217
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YXJ6
Sequence length 391
Comment (tr|M3YXJ6|M3YXJ6_MUSPF) Neutrophil cytosolic factor 1 {ECO:0000313|Ensembl:ENSMPUP00000016056} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NCF1 OC=Mustelinae; Mustela.
Sequence
MGDTFIRHIALLGFEKRFVPSQHYFIYIYIYIYIYLKYMIPSRCLHLFFRVQKLLKEMFP
IEAGDINPQNRIIPHLPAPRWFDGQRAAESRQGTLTEYCNALMSLPVKISRCPQLLDFFK
VRPDDLKLPTDSQTKKPETYLVPKDNNSVSDITGPIILQTYRAIADFEKTSGSQMALATG
DVVDVVEKSESGWWFCQTKTKRGWVPASYLEPLDSPDESEDPEPNYEGEPYVTIKAYTAE
MEDEVSLQEGETIEVIHKLLDGWWVIRKDDITGYFPSMYLQKSGQDVAQAQRQIKSRGAP
PRRSSIRNAHSIHQRSRKRLSQDTYRRNSVRYLQQRRRPGRPGPRSAASPHREQQESERA
KPQPAVPPRPSADLILHRCSESTKRKLASPV
Download sequence
Identical sequences M3YXJ6
ENSMPUP00000016056 ENSMPUP00000016056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]