SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXU6
Domain Number 1 Region: 330-398
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000523
Family Ran-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YXU6
Sequence length 463
Comment (tr|M3YXU6|M3YXU6_MUSPF) Nucleoporin 50 {ECO:0000313|Ensembl:ENSMPUP00000016156} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NUP50 OC=Mustelinae; Mustela.
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLVVPSGGGGFSGFGNGAGGKPLEGLSNGSGVNSAPPFSGARAATESKAAFGSVAANG
PTSLVDKKVLTPKTNGDSPQPSSSGPPSGAACPRSAYHKQLAALNCSVRDWIAKHVNANP
LCDLTPIFRDYERHLAGIEQQHGSGGGRGSEREAGPVPLATQSPSLFGAAKPQQDSAFPF
AGGRAEDGAERKTEPPAGAASASFSFGKKIDGSVLGSPNSGPLTGFSFSSGNSSFFGKDL
TQNKPASSPFSAKTLEVQAEGGTSDCKGGDEEASDEPPKVVVTEVKEEDAFYSKKCKLFY
KKDNEFKEKGVGTLHLKPTATQKTQLLVRADTNLALLAGEPQRAALLTVLPSLEGPREGS
GSSQRVLPPLQHPAERSDSAQHAVYPDGEEQRPDRVCPQPARR
Download sequence
Identical sequences M3YXU6
XP_004771186.1.14098 XP_012900569.1.14098 ENSMPUP00000016156 ENSMPUP00000016156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]