SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXV4
Domain Number 1 Region: 1693-2019
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.01e-89
Family Rap/Ran-GAP 0.00018
Further Details:      
 
Domain Number 2 Region: 1064-1442
Classification Level Classification E-value
Superfamily ARM repeat 0.000000288
Family Exportin HEAT-like repeat 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YXV4
Sequence length 2038
Comment (tr|M3YXV4|M3YXV4_MUSPF) Ral GTPase activating protein catalytic alpha subunit 1 {ECO:0000313|Ensembl:ENSMPUP00000016164} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=RALGAPA1 OC=Mustelinae; Mustela.
Sequence
MFSKKPHGDVKKSTQKVLDTKKDALTRLKHLRIVIENAESIDLKQFFDQHFSHIYYVFFE
NFVTIEASLKQKGHKSQREELDAILFIFEKILQLLPERIHQRWQFHSIGLILKKLLHTGN
SLKIRREGVRLFLLWLQALQNNCSKEQLWMFSCLIPGFSALQSEHGPRTLDNLINPPLNL
QETQVTIEEITPLVPPQSGDKGQEDLTSYFLEALLKYIVIQVKSLEWKNKENQERGFSFL
FSHFKKYYLPYIFPNICKENSLYHPVLDIPQVRPKPHYVMIKKDAETNEAIYCTKEPFIK
ARVIVIRWLVSFWLEPKPHTGPHIPGMEGEVLPKNIQRAAASLVSREENKNDNADKADRA
TEPEQSHSNTSTLTEREPSSSSLCSIDEEHLTDIEIVRRVFSSKRSNVNFVTEIFRQAFL
LPICEAAAMRKVVKVYQEWIQQEEKPLFMQEPEEIVISSSDLPCIDNVTDHVISMEEGEK
REEVNCSNTLKGVNQINWVREMRNWRHLKNVQKKSDHRSMRLKRKAVIIVFIINSSNIFL
LEPANEIKNLLDEHTDMCKRILNIYRFMVVQVSMDKKTWEQMLLVLLRVTESVLKMPSQA
FLQFQGKKNMTLAGRLAGPLFQTLIVAWIKANLNVYISRELWDDLLSVLSSLTYWEELAT
EWSLTMETLTKVLARNLYSLDLSDLPLDKLSEQKQKKHKGKGVGHEFQKVSVDKSFSRGW
SRDQPGQAPMRQRSATTTGSPGTEKARSIVRQKTVDIDDAQILPRPTRVRHFSQSEDTGN
EVFGALNEEQPLPRSSSTSDILEPFTVERAKVNKEDMSPKLPPLNSDIGSSSANVPDLMD
EFIAERLRSGNASTMTRRGSSPGSLEIPKDLPDILNKQNQMRPIDDPGVPSEWTSPASAG
SSDLISSDSHSDSFSAFQYDGRKFDNFGFGADAGITSSADVDSGSGHHQSAEEQEVASLT
TLQIDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLNIDNMEQKDLQL
DEKLHHSVLQTPDDLEISEFPSECCSVMAGGTLTGWHADVATVMWRRMLGILGDVNAIMD
PEIHAQVFDYLCELWQNLAKIRDNLGISTDNLTSPSPPVLIPPLRILTPWLFKATMLTDK
YKQGKLHAYKLICNTMKRRQDVSPNRDFLTHFYNIMHCGLLHIDQDIVNTIIKHCSPQFF
SLGLPGATMLIMDFIVAAGRVASSAFLNAPRVEAQVLLGSLVCFPNLYCELPALHPNIPD
IAVSQFTDVKELIIKTVLSSASMSVSGHAKCVALCSLGIWICEELVHESHHPQIKEALNV
ICVSLKFTNKTVAHVACNMLHMLVHYVPRLQIYQPDSPLKIIQILIATITHLLPSTEASS
YEMDKRLVVSLLLCLLDWIMALPLKTLLQPVHATGAENDKIEKSVLNCIYKVLHGCVYGA
QCFSNPRYFPMSLSDLASIDYDPFMHLESLKEPEPLHSPDSERSSKLQPVTEVKTQMQQG
LISIAARTVITHLVNHLGHYPMSGGPAMLTSQVCENHDNHYSESTELSPELFESPNIQFF
VLNNTTLVSCIQIRSEESIPGGGLSAGLASANSNVRIIVRDLSGKYSWDSAILYGPPPVS
GLSEPTSFILSLSRQEKPEEPPTSNECLEDITVNDGISLQFKRGFRETVPTWDTIRDEED
VLDELLQYLGITSPECLQRTGISLNIPAPQPVCISEKQENDVINAILKQHTEEKEFVEKH
FNDLNMKAVEQDEPTPQKPQSAFYYCRLLLSILGMNSWDKRRSFHLLKKNEKLLRELRNL
DSRQCRETHKIAVFYVAEGQEDKHSILTNTGGSQAYEDFVAGLGWEVNLTNHCGFMGGLQ
KNKSTGLTTPYFATSTVEVIFHVSTRMPSDNDDSLTKKLRHLGNDEVHIVWSEHTRDYRR
GIIPTEFGDVLIVIYPMKNHMFSIQIMKKPEVPFFGPLFDGAIVNGKVLPIMVRATAINA
SRALKSLIPLYQNFYEERARYLQTIVQHHLEPTTFEDFAAQVFSPAPYHHLPSDAGDH
Download sequence
Identical sequences M3YXV4
ENSMPUP00000016164 ENSMPUP00000016164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]