SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXW5
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-56
Family Necap1 N-terminal domain-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YXW5
Sequence length 266
Comment (tr|M3YXW5|M3YXW5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000016175} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEEGEYESVLCVKPEVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQVAYIKLE
DRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFVDRGDAFDFNV
ALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGTPRARPA
STGGLSLLPPPPGGKTSTLIPPPGEQVSVGGSLVQTAVGPSSGGATVSWPQPRPATTATT
DIWGDFTKSTGSTSSQTPPGTGWVQF
Download sequence
Identical sequences M3YXW5
ENSMPUP00000016175 XP_004741433.1.14098 ENSMPUP00000016175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]