SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXY2
Domain Number 1 Region: 372-571
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-49
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 711-774
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-16
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 571-696
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000252
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YXY2
Sequence length 796
Comment (tr|M3YXY2|M3YXY2_MUSPF) Rho guanine nucleotide exchange factor 19 {ECO:0000313|Ensembl:ENSMPUP00000016192} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGEF19 OC=Mustelinae; Mustela.
Sequence
MDCGPPATLPSHLAGPRGTDRRPVAVCQQESLSFAELPTLQPPSPVCLDLFPVAPEELRA
PGSRWSLGTPTPLQGLPWPPSPEVPDTEISTSGGLRPSRAGSWPHCPSAQPQALEGPWSP
QHPQPQRRASHGSEKKSAWRKMRVYQREELPGSPGAHAVFLEPGQAAEQTLSTEEPRPPE
LSLPSRVGLEGPERRRFSASELMTRLHSSLRLGRNSAARVLTPGSGTGAAREGRSSGRES
RSVEMRVDGLVMPAPIDPSGCHSGWPEPRLYTPEELALGSRSSSERRQSRFLLNSTWDEG
AGGGGAGPAEVGPRKRGPGGAEPSGEETPSGRRTERARLGGAGPMGGARGSTPQSRSSGG
PVQPFRSRLPLTQAKFELITSEASYIHSLSVAVGHFLGSAELSECLGVQDKQWLFSKLPE
VKSTSERFLQDLEQRLEADVLRFSVCDIVLHHCPAFRRVYLPYVTNQAYQERTYQRLLLE
NPKFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMATRA
FNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAPLP
AAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHARMAELQVKDLSRKLQGVPGH
VFLLQLLHGPHAKHQFLLRARTESEKQRWISALCPSSSQEDKEFFSEGQDRPQVQCVRTY
KALQPDELTLEKTDILAVRTQTSDGWLEGVRLADGEKGWVPQAYVEEISSLSARLRNLRE
NKRITSAPSKLGEPPA
Download sequence
Identical sequences M3YXY2
ENSMPUP00000016192 ENSMPUP00000016192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]