SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YXZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YXZ4
Domain Number 1 Region: 37-176
Classification Level Classification E-value
Superfamily PX domain 0.00000000000139
Family PX domain 0.01
Further Details:      
 
Domain Number 2 Region: 211-408
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000126
Family BAR domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YXZ4
Sequence length 412
Comment (tr|M3YXZ4|M3YXZ4_MUSPF) Sorting nexin {ECO:0000256|PIRNR:PIRNR036924} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
APGPATPQEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKS
SLPNFKQNEFSVVRQHEEFIWLHDSFIENEDYAGYIIPPAPPRPDFDASREKLQKLGEGE
GSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRKDLNFHVFLEYNQDLS
VRGKNKKEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRM
TRSHKSAADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLKLSD
LLKYYLRESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKI
SESAKQELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
Download sequence
Identical sequences M3YXZ4
ENSMPUP00000016204 ENSMPUP00000016204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]