SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YY16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YY16
Domain Number 1 Region: 612-716
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-20
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YY16
Sequence length 862
Comment (tr|M3YY16|M3YY16_MUSPF) Pleckstrin homology and RUN domain containing M2 {ECO:0000313|Ensembl:ENSMPUP00000016226} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLEKHM2 OC=Mustelinae; Mustela.
Sequence
MPDYYKPQYLLDFEDRLPSSVQGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVF
PAVPSVPSTDWEDGDLTDTVSGPRSTTSDPTSSKASTKSPTQRHNPFSEDPAETVSSSDT
TPVHTTSQEKGESHTLDLPDTCTELEVIRVTKKKKTGKKKKTRSDEEASPLHPASTQDTG
ARRGDGDSLVSSPGLGRASPDATITPPQEEGEGPGSTAESSELSEPGQMGLLIPEMKDTS
MERLGQPLSKVIDQLNGQLDPSTWRSHVQSPDQSFRTGSPGEAPEKPPFCDFSEGLPAPM
DFYRFTVESPSTLTAGGSNHDSAGPGQPLHVPGSPATAGQEEGGGGREGQTPGPLEDAPP
REAPEPGTQEPDAKLPLVGEGPEPELEPGTHETLCQLKRDQPSPCLSSAEDSGVDEGQGS
PSDMSHSAEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVY
LLRKGAAEKPYLVEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAEFFLA
SLKSAMIKGCREPPYPSVLTDATMEKLALAKFVAQESKCEATAVTVRFYGLVHWEDPMDE
SLGPIPCHCSPPEGVITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVTPL
LSVNMGGEQCGGCRRANTTDRPHAFQVILADRPCLELSADSEADMADWMQHLCQAVSKGV
IPQGVTPSPCIPCCLVIAADRLFTCHEDCQTSFFRSLGTAKLADVSAVATEPGKEYCVLE
FSQDSQQALPPWVIYLSCTSELDRFLSALSSGWKTIYQVDLPHKAIQEASNKKFEDALSL
IHSAWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences M3YY16
ENSMPUP00000016226 ENSMPUP00000016226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]