SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YY29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YY29
Domain Number 1 Region: 177-450
Classification Level Classification E-value
Superfamily Caspase-like 3.44e-88
Family Caspase catalytic domain 0.000000000444
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-24
Family Caspase recruitment domain, CARD 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YY29
Sequence length 451
Comment (tr|M3YY29|M3YY29_MUSPF) Caspase 9 {ECO:0000313|Ensembl:ENSMPUP00000016239} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CASP9 OC=Mustelinae; Mustela.
Sequence
MDEADRQILRRCRVQLVNELQVAPLWDVLLTRQLFTPAMIEDIQHAGSGSRSDQARQLVI
DLETRGSQALPLFISCLEDTDQNKLASVLRALRQAEKQNPEVIRPQDPMPVVVRALGLTP
EDLRGKQGPSKATPGKLAPVVLGPEQLWPAKLRPEVLRPEMPRPVDSGSGRFSDVCAPEI
SKQNADLAYALNADPCGHCLIINNVNFCLESRLTARTGSNIDCEKLRQRFHLLHFMVEVK
CDLTAKQMVQALVELARRDHSALDCCVVVVLSHGCQASHLQFPGAVYGTDGCPVAIERIV
NIFNGAGCPSLGGKPKLFFIQACGGEQKDHGFEVASASPEDRTPGSDPESDAVPFQEGPG
PCDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTKSGSWYVETLDGVFEQWAHSEDLQTLL
LRVANAVSQKGIYKQIPGCFNFLRKKLFFKV
Download sequence
Identical sequences M3YY29
ENSMPUP00000016239 ENSMPUP00000016239 XP_004741476.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]