SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YY50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YY50
Domain Number 1 Region: 63-169
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.69e-34
Family MBT repeat 0.001
Further Details:      
 
Domain Number 2 Region: 405-518
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.65e-32
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 288-395
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.76e-27
Family MBT repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 180-295
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.78e-27
Family MBT repeat 0.00000063
Further Details:      
 
Domain Number 5 Region: 817-889
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.8e-17
Family SAM (sterile alpha motif) domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YY50
Sequence length 894
Comment (tr|M3YY50|M3YY50_MUSPF) Scm like with four mbt domains 2 {ECO:0000313|Ensembl:ENSMPUP00000016260} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SFMBT2 OC=Mustelinae; Mustela.
Sequence
MEGSLSASSMQEPASSPPEKQQSSASGHGGLDSEEGSGLEEIGFNWGEYLEETGASAAPH
TSFKHVEISLQSNFQPGMKLEVANKNNPDTYWVATVITTCGQLLLLRYCGYGEDRRADFW
CDVVIADLHPVGWCTQNNKALMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGK
GPIDLITVDSLIELQDSQSPFQYWIVSVIENVGGRLRLRYVGLEDTESYDQWLFYLDYRL
RPVGWCQENKYRMDPPSEIYPLKMASEWKCALEKSLADAAQFPLPMEVFKDHADLRSHFF
TVGMKLETVNLSEPFHICPASVTKVFNNHFFQVTIDDLRAEPSNLSMLCHADSLGILPVQ
WCLKNGVNLTPPKGYSGQDFDWADYHKQHGTEEAPPFCFRNTTFSRGFTKNMKLEAVNPR
NPGELCVASVVRVKGRLMWLHLEGLQTPSPEFIVDVESMDIFPVGWCEANSYPLTTPHKT
IAQKKRKIAVVQPEKQLPSTVPVEKIPHDLCLFPHLDTAGPVNGKYCCPQLFINHRCFSG
PYLNKGRIAELPQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQLVEDPHWNFQEETL
KAKYRGKTYRAVAKIVRTSDQVADFCRRVCAKLECCPNLFSPVLVSENCPENCSIHTKTK
YTYYYGKRKKIVKPPIGEASTESGHPKPARRRKRRKSIFVQKKRRSSAVDLAVGSGEESE
EEDGDAVDEDTGSEETGSELRDDQTDTSSAEVPSARPRRAVTLRSSSEPERRPPVERPRR
GRRAQAASCTEGAEQGVATGQDPAEDTKQQEEERLVLESNPLEWTVTDVVRFIKLTDCAP
LAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN
Download sequence
Identical sequences M3YY50
XP_012914565.1.14098 ENSMPUP00000016260 ENSMPUP00000016260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]