SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YYM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YYM2
Domain Number 1 Region: 16-147
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.8e-40
Family Gelsolin-like 0.00000477
Further Details:      
 
Domain Number 2 Region: 612-731
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.75e-37
Family Gelsolin-like 0.0000298
Further Details:      
 
Domain Number 3 Region: 388-524
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.54e-37
Family Gelsolin-like 0.0000316
Further Details:      
 
Domain Number 4 Region: 249-436
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.59e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.01
Further Details:      
 
Domain Number 5 Region: 511-611
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.97e-25
Family Gelsolin-like 0.0002
Further Details:      
 
Domain Number 6 Region: 757-827
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 4.19e-23
Family VHP, Villin headpiece domain 0.00011
Further Details:      
 
Domain Number 7 Region: 123-233
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.71e-19
Family C-terminal, gelsolin-like domain of Sec23/24 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YYM2
Sequence length 827
Comment (tr|M3YYM2|M3YYM2_MUSPF) Villin 1 {ECO:0000313|Ensembl:ENSMPUP00000016432} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=VIL1 OC=Mustelinae; Mustela.
Sequence
MTKLSAQVKDSLNVTTPGVQIWRIEAMKMVPVPSSTFGSFYDGDCYIVLAIHKTGSNLSY
DIHYWIGQASSQDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKG
GVASGMKQVKTNSYEVRRLLHVKGKRNVVAGEVEVSWNSFNCGDVFLLDLGRIIIQWNGP
EGSRMERLRGMTLAKEIRDQERGGRTYVGVVDGENETESPKLMEIMNHVLGQRGSLKAAV
PDDLVEPAVKAALKLYHVSDSEGKLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKG
KNANAQERTGAMNQALNFIKAKQYPPSTQVEVQNDGAESAVFQQLFQKWTLPNQTSGLGK
THTLGSVAKVEQVKFDATSMHVQPQVAAQQKMVDDGSGEVEVWRIEDLELVPVDSKWLGH
FYGGDCYLLLYTYLIGEKKHYLLYIWQGSQASQDEIAASAYQAVILDQKYNNEPVQIRVP
MGKEPPHLLAIFKGRMVVYQGGTSRANQLEPVPSTRLFQVQGTSANNTKAFEIQPRASSL
NSNDVFILKTQSCCYLWCGKGCSGDEREMAKMVSDNISRTEKQVVVEGQEPASFWVALGG
KAPYASTKRLKEETLAITPRLFECSNQTGRFLATEIPDFNQDDLEEEDVFLLDVWDQVFF
WIGKHANEEEKKAAAITAQEYLKTHPSGRDPETPIIVVKQGHEPPTFTGWFLAWDPFKWN
NTKSYEDLKAELGNSGDWGEITVEITSSKLDTFDVNSNLVSGPLPIFPLEQLVNKPVEEL
PEGVDPSRKEAHLSIEDFTKAFGMTPTAFSALPRWKQQNLKKEKGLF
Download sequence
Identical sequences M3YYM2
XP_004762816.1.14098 ENSMPUP00000016432 ENSMPUP00000016432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]