SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YYP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YYP8
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.1e-89
Family IMD domain 0.000000301
Further Details:      
 
Domain Number 2 Region: 337-401
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000171
Family SH3-domain 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YYP8
Sequence length 511
Comment (tr|M3YYP8|M3YYP8_MUSPF) BAI1 associated protein 2 like 1 {ECO:0000313|Ensembl:ENSMPUP00000016458} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BAIAP2L1 OC=Mustelinae; Mustela.
Sequence
MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGE
IATGSPVSTELGHVLIEISSTHKKLNESLDENFRKFHKEIIHELEKKIELDVKYMNATLK
RYQTEHRNKLDSLEKSQAELKKLRRKSQGGRNALKYEHKEIEYVETVTSRQSEIQKFIAD
GCKEALLEEKRRFCFLVDKHCSFANHLHYYHLQSAELLNSKLPRWQETCGDATKVPEKIM
NMIEEIRTPSSTPVSGTPQPSPMIERSSMVGKDYDTLSKYSPKVPPAPSARAYTSPLIDM
FNNPATVGQNSEKIKNSTDSSDDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNQTLLS
FAQGDILTLLVPEEKDGWLYGEHDTTKVRGWFPASYTKLLEEDAEEALSVPTPSPAPVRS
ISTVNLSEKSRVVIPPPDYLECLSLGAAADKRADGSTSISTFKAPVSKPEATSPNDANGT
AKPPFLSGENPFATVKLRPTVTNDRSAPIIR
Download sequence
Identical sequences M3YYP8
XP_004775014.1.14098 ENSMPUP00000016458 ENSMPUP00000016458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]