SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YYS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YYS2
Domain Number 1 Region: 629-639,666-1028
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 7.06e-97
Family Formin homology 2 domain (FH2 domain) 0.0000222
Further Details:      
 
Domain Number 2 Region: 103-184
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-22
Family PDZ domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YYS2
Sequence length 1044
Comment (tr|M3YYS2|M3YYS2_MUSPF) Grid2 interacting protein {ECO:0000313|Ensembl:ENSMPUP00000016482} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GRID2IP OC=Mustelinae; Mustela.
Sequence
MGKDQGFSRHFRIFIPKKHRARFDEVVSQGLLGKLCRARRAQGAQGLRRSRSEERPERLL
VSTRASAAPRRXXXXXXXXXXXXXXXXXXXXXSLLGGRAGPGGTRRTVRVYKGNKSFGFT
LRGHGPVWIESVLPGSPADNASLKSGDRILFLNGLDMRNCSHDKVVSMLQGSGAMPTLVV
EEGLVPFASDSDSLDSPNPSSALTSLQWVAEILPSSIRVQGRTFSQQLEHLLTPPERYGI
CRALESFFQHRNIDTLIVDVYPVLDTPAKQVLWQFIYQLLTYEEQELCQEKIACFLGYTA
MTEPEPELDLEPELEPEPEPVPELQRRSSLRASSMCRRSLRSQGLEASLSCGPGDCPEMP
LPLIPGERQAGDGTSLPETPNPKMMSAVYAELESRLNSSFKGKVGTTSRSRASPPVPSPV
GPAGPRTLSSISWPSERLLPSPCYYPLCSGGLASPSSSESHPYASLDSSRAPSPQPDPGP
IRSDSPPSPDPARPPSRRKLFTFSRPVQSRDTDRFLDVLSEQLGSRVTVVDDFLSPENDY
EEMSFHDDQGSFVTNERSSASECISSSEEGSSLTYSSISDHIPPPPLSPPPPPPLPFHDP
KPSSRTPDGPRGPPQTLAKPLTQLSHPVPPPPPPPLPPPVPCAPPMLSRGLGHRRSETSH
MSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFR
KKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEPRRLERAHLAQLLLFAPDADEE
QRYQAFREAPGRLSEPDQFVLQMLSVPEYKTRLRSLHFQATLQEKTEEIRGSLECLRQAS
LELRNSRKLAKILEFVLAMGNYLNDGQPKTNKTTGFKINFLTELNSTKTVDGKSTFLHIL
AKSLSQHFPELLGFAQDLPTVPLAAKVNQRALTSDLADLHGTISEIQAACQSMCPSSEDK
FAVVMTSFLETAQPVLRALDGLQREAMEELGRALAFFGEDSKATTSEAFFGIFAEFMSKF
ERALSDLEAGDGPRSSGMVSPLAW
Download sequence
Identical sequences M3YYS2
ENSMPUP00000016482 ENSMPUP00000016482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]