SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YYT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YYT3
Domain Number 1 Region: 444-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.22e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 612-668
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.72e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 556-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.41e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 9 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000946
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Weak hits

Sequence:  M3YYT3
Domain Number - Region: 136-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00834
Family Classic zinc finger, C2H2 0.069
Further Details:      
 
Domain Number - Region: 208-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0405
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YYT3
Sequence length 695
Comment (tr|M3YYT3|M3YYT3_MUSPF) Zinc finger protein 12 {ECO:0000313|Ensembl:ENSMPUP00000016493} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZNF12 OC=Mustelinae; Mustela.
Sequence
MSKSLGPVSFRDVAVNFTQEEWQQLEPEQKTTYRDVMLENYSHLVSVGCHIIKPEVIIKL
EQGEEPWIVEGEFLPQSYPGDVWKADVLGERVQENESKYSRQAVSNNKTLIEERGNVLGK
TSNAETNPIPSRKMSYKCDSCEKSLKSISEYISSDGSYARMKPDECSACGKPLPQIKLEK
THPGDESYEFNQNGDAYSLNEESIYHNINILEKPFEYIECQKAFQKDTVFVNHMEEKPYK
WNESEIAFLQMSNLRVHERSHMELKPYECNACGKSFCKKSKFIIHQRTHTGEKPYECNQC
GKSFCQKGTLTVHQRTHTGEKPYECNECGKTFYQKLHLIQHQRTHSGEKPYECSYCGKSF
CQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLYKCNECGKCFCRKS
TLTTHQRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECNECGKTFYLNSALMR
HQRVHTGEKPYECTECGKLFSQLSYLTIHHRTHSGVKPYECNECGKTFYQNSALCRHRRI
HKGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECNECGKTFCQNSALNRHQRTHTGE
KAYECYECGKFFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLTVHYRTHSGEKPYE
CNECGKKFYHKSAFNSHQRIHRRGNVSVLDVGRLL
Download sequence
Identical sequences M3YYT3
XP_004775063.1.14098 ENSMPUP00000016493 ENSMPUP00000016493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]