SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YYT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YYT8
Domain Number 1 Region: 23-156
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-35
Family Phosphotyrosine-binding domain (PTB) 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YYT8
Sequence length 222
Comment (tr|M3YYT8|M3YYT8_MUSPF) Docking protein 6 {ECO:0000313|Ensembl:ENSMPUP00000016498} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DOK6 OC=Mustelinae; Mustela.
Sequence
MECLGTRLNDISLGEPDLLAAGVQREQNERFNVYLMPTPNLDIYGECTMQITHENIYLWD
IHNAKVKLVMWPLSSLRRYGRDSTWFTFESGRMCDTGEGLFTFQTREGEMIYQKVHSATL
AIAEQHERLMLEMEQKARLQTSLTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHG
FGSSKMSRAQTFPSYASEPSDETQALSRAGSYGFSSSSSLIQ
Download sequence
Identical sequences M3YYT8
ENSMPUP00000016498 ENSMPUP00000016498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]