SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YZ62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YZ62
Domain Number 1 Region: 24-186,213-337
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-63
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 500-694
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000654
Further Details:      
 
Domain Number 3 Region: 743-807
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000104
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3YZ62
Sequence length 1085
Comment (tr|M3YZ62|M3YZ62_MUSPF) SLIT-ROBO Rho GTPase activating protein 1 {ECO:0000313|Ensembl:ENSMPUP00000016622} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SRGAP1 OC=Mustelinae; Mustela.
Sequence
MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRP
PNVPPKPQKHRKSRPRSQYNAKLFNGDLETFVKDSGQIIPLIVESCIRFINLYGLQHQGI
FRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDL
ISCIRIDNLCERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMPVPEIQDQVSCQAHVNEIVKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYS
EHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYMGRSARELSFKKGASLLLYHRASEDW
WEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRH
PDSYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLGGHPRGLLQNR
GLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQ
DIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNAPTPATSTESLSPLHNVALRSS
EPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPSQGPAD
KSCTM
Download sequence
Identical sequences M3YZ62
ENSMPUP00000016622 XP_004766654.1.14098 ENSMPUP00000016622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]