SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YZI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YZI2
Domain Number 1 Region: 15-118
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-21
Family PDZ domain 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3YZI2
Sequence length 290
Comment (tr|M3YZI2|M3YZI2_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000016742} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
PKRTDLASGETQTGFNVKSSVHNLSKTQQTKLTVGNLGLGLIVIQNGPYLQITHLIRNGA
AARDGKLKPGDVLISVGHANVLGYTLREFLKLLQHITIGTVLQIKIYRDFIDIPQEWQEI
YDLIPETKFPVTCPTKKTEESKDDLLASSDDNEDVVSDKNLKYYKDPGSPGPQSATRPMS
ISREWHGYKKENQTISVGKDIQSDVMIHRDHKKEVRAPSPYWTMVKHDKESSSSSTASST
SDAFWMEDYAQAEKSKVPPVSKAPTQAEKSKVPPVSKAPTQXXXXXXXPG
Download sequence
Identical sequences M3YZI2
ENSMPUP00000016742 ENSMPUP00000016742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]