SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YZR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YZR6
Domain Number 1 Region: 78-179
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-25
Family PDZ domain 0.0026
Further Details:      
 
Domain Number 2 Region: 204-306
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-22
Family PDZ domain 0.00087
Further Details:      
 
Domain Number 3 Region: 862-958
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-19
Family PDZ domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YZR6
Sequence length 985
Comment (tr|M3YZR6|M3YZR6_MUSPF) PDZ domain containing 7 {ECO:0000313|Ensembl:ENSMPUP00000016827} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PDZD7 OC=Mustelinae; Mustela.
Sequence
MAQGFAVGFDPLGLRDLSSGSLSSLSSRGHLGSDSGSATRYLLKRQQRLLNGPPRGIRAS
SPMGRVILINSPIEANSNESDIIRAVRVEKSPAGRLGFSVRGGSEHGLGIFVSKVEEGSS
AERAGLCVGDKITEVNGLSLESTTMGSAVKVLTGSSRLHLTVRRMGRVPGIRFSKEKTTW
VDVVNRRLVVEKCSSTPSDSGSEDGVRRIVHLYTTSDDFCLGFNIRGGKEFGLGIYVSKV
DHGGLAEENGIKVGDQVLAANGVRFDDISHSQAVEVLKGQTHIMLTIKETGRYPAYKEMV
SEYCWLDRLSNGVLQQLSPASESSSSVSSYASSAPYSSAEGSGSLPSDRMDVCLGPDEPG
SWGPGWGRADTAMQTEPDVGGHVETWCSVRPTVILRDTAIRSNGPWPDHRLDSALSESPK
TALLLALSRPRPPITRSQSHLTLWELEPWVGESPPPQHPGCSLMSAEEKKQRKKKLGSSG
EKGALQRSKTLMNLFFKGGRQGRLAGDGHREAWTLDGGSPAKPRPRLDPEKERERGRALL
SARSGSPSSQLPSMDEQVQAWESRRPLIQDLARRLLTDDEVLAITRHCSRYVHEGGVEDL
VRPLLAILDRPAKLLLLRDIRSVVAPTDLGRFDSMVMPVELEAFEALKSRAAVRPPALRP
ARKDTPPKRHLITPVPDSRGGFYLLPVNGFSEEDDNGELREQLGDLQLSLGASAPHHPHK
GIPPLQDVPVDAFAPHRSTSTPPPQPPPVTPRPPRPNWLLTEPLTPEDPRQSQSQGLAQS
RSRSRSRSRSHSRCRGKSPGRRRSPSPAPIPTPSAADGRYHKPRKARPPLPRPVDEQAAK
AGSRQGHSENGTGRTAREATEKAPGGELRTVTLSKMKQSLGISISGGIESKVQPMVKIEK
IFPGGAAFLSGALQAGFELVAVDGESLEQVTHQRAVDTIRRAYRNKAREPMELVVRVPRT
SPLPLPSDLSALTDQCLPVDHSPAH
Download sequence
Identical sequences M3YZR6
ENSMPUP00000016827 ENSMPUP00000016827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]