SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3YZZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3YZZ2
Domain Number 1 Region: 245-344
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-23
Family PDZ domain 0.000028
Further Details:      
 
Domain Number 2 Region: 77-212
Classification Level Classification E-value
Superfamily TRAF domain-like 1.05e-23
Family SIAH, seven in absentia homolog 0.0057
Further Details:      
 
Domain Number 3 Region: 414-504
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-22
Family PDZ domain 0.00000916
Further Details:      
 
Domain Number 4 Region: 10-81
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000108
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3YZZ2
Sequence length 1035
Comment (tr|M3YZZ2|M3YZZ2_MUSPF) PDZ domain containing ring finger 3 {ECO:0000313|Ensembl:ENSMPUP00000016903} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PDZRN3 OC=Mustelinae; Mustela.
Sequence
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRL
SAKELNHVLPLKRLILKLDIKCAHAARGCNRVVKLQQLPEHLERCDFAPARCRHAGCGQV
LLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNAALQARLGAL
HKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGG
KGEETKSLTLVLHRDSGSLGFNIIGGRPCVDNQDGSSTEGIFVSKIVDSGPAAKDGGLQI
HDRIIEVNGKDLSRATHDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSESQLVDTGTQT
DITFEHIMALTKMSSPTPPVLDPYLLPEEHPSAHEYCDPSDYMGGIHQEMDREELELEEV
DLYRMNSQDKLGLTVCYRTDDEDDLGIYISEIDPNSIAAKDGRIREGDRIIQINGIEVQN
REEAVALLTSEENKNFSLLIARPELQLDEGWMDDDRNDFLDQLHMDMLEEQHHQAMQFTA
GVLQQKKHEEDGGTTDTATILSNQHEKDSGVGRTDESTRNDESSEQENNGDDATASSTPL
AGQRKLTCSQDTLGSGDLPFSNESFLSADCADADYLGIPVDECERFRELLELKCQAKSSS
PYSLYYASSPLDASKSDPESVDKELELLNEELRSIELECLSIVRAHKMQQLREQYRESWM
LHHSGFRNYNTSVDVRRHELSDITELPEKSDKDSSSAYNTGESCRSTPLTLEMSPDNSLR
RVAEGGGCAGGEGAAGSAEAYGPCPRNLLSITEDPEAGGASYSPAAAPRAGAQPGPGEQG
AEAQRRRRQPGPEPQAGRLLPATFPALALQTRAHPGARAALPELHAADPAEVGRGVCAEP
DEPGEHVQGPALGRRRRGPHGVEGQGPQRRHALHHQAAGARPPAAGARAQDPRGAQRHDH
RRRRGERAEAGPLLEQGGAQAARGEGQGAAAPARVHDAEPARLPEGAAGGRRQEGDEHPR
TEPQKDDEEEEQKDL
Download sequence
Identical sequences M3YZZ2
ENSMPUP00000016903 ENSMPUP00000016903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]