SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z052 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3Z052
Domain Number - Region: 134-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000668
Family B-box zinc-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z052
Sequence length 834
Comment (tr|M3Z052|M3Z052_MUSPF) Zinc finger B-box domain containing {ECO:0000313|Ensembl:ENSMPUP00000016963} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ZBBX OC=Mustelinae; Mustela.
Sequence
MNSKDFVVLPWGKPGNSIKLKYKNAQELRMEKVQLELENQQMEKKLQEFQSAWSKEKEER
ESSGYHWKSGRVGKLGNQSHTMSQNKKNIIKFSAGKVKLKLLKEQLQDPVKPQLNYKMAN
PSESKKSKIKGKVCGQCENKAALLVCLECGEDYCLGCFAKIHQKGALKLHRTTLLQAKSQ
MLSNVLDAAHRFIKEVNPDEPKGNNHSEEEISKSENKPKSLLQGSHSGVEVPTTKRAECS
HPKDRLLCEGSFDEEASAQSFPETLNQWRTGHQDDNEKQNPPAAKADSLEECEVQTNLKI
WREPLNIEFKEDSLSYMEKLWLKKHRRTPQEQLRNMLPNTFIPQCKTASEAQCSQNESDE
DSDVEETKVQYPAPFLPVEELNIERPEPSLKIVELDDTYEEEFEEPGDPVPYKVELADAD
SQQSCTFHEYQNTFLYETDIHQHHVSTKEKTDLLHLHLNNSSSYCKNNSKAGTSDTEFEI
IVDPDVYFPAIEKIGESSISERNFKDKMIDTESNQKSGDSCVSLESKASLPSIDLKKPSI
KEQLPQDIKESLEFSNLHERPNFEDSKATESPLLLQEIALRSKPITEQYQGLERFFVFDK
NERLNLLPSHSLECSYSSTRITTAGDREWIPDRSISTYADNAVTLGVQQSAQNPSMSRTQ
RKMGQISQRPSTANLSLSNSVKKSSSCLVSSHPRSRSAGARPLSRAASEISEIEYIDTTH
HTEPFLDGTADQQTLDSLEKELNVLRNLADPSEKLYSLTSEELPAFNNHSLNISQTTLDF
CKTSSARGLCAVEEWSSFERDTEAQSLLTLSESSTDEEEEDFLDKQHVIMLSWS
Download sequence
Identical sequences M3Z052
ENSMPUP00000016963 ENSMPUP00000016963 XP_004756557.1.14098 XP_012913737.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]