SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z097 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z097
Domain Number 1 Region: 639-716
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-20
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 2 Region: 1109-1167
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 720-808
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-18
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z097
Sequence length 1169
Comment (tr|M3Z097|M3Z097_MUSPF) Sorbin and SH3 domain containing 1 {ECO:0000313|Ensembl:ENSMPUP00000017008} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SORBS1 OC=Mustelinae; Mustela.
Sequence
MSSECDVGASKAVVNGLAPGSNGQDKDMDPTKICTGKGAVTLRASSSYREIPSSGPTSPQ
ETPQHESKPVLDSETPSADEWRLSSNADANGNAQPSSLAAKGYRSVHPNLPSDKPQGASS
SSSAQPEDSGPLLNEVSSSHVGTDPQSSAPASKPSSAYPSTTIVNPTIVLLQHNREQQKR
LSSLSDPVSERRVGEQDLAPTQEKPTSPGRATEKKVKDDSRRVARSAQDLSDVSMDDVGI
PLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYQFPELPEIQQNSEEDNPYTPTYQF
PASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSYIDGEKVVKRSATLPLPAR
SSSLKSSPERNDWEPPDKKVDTRKYRAEPKSIYDYQPGKSSVLTNEKMSRDISPEEIDLK
NEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRKTNLEKYLNLCPAELEAHLENTE
TLNKAPSANLSQSSAVSPSPDISAEAPGYIYSSNFHAVKRESDGAPGDLASLENERQIYK
SVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPADYLESTEEFIRRRHDDKEKLLAD
QRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFD
FKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIFPRSYIELLPPAEKAQPKKLAP
VQVLEYGEAVAKFNFNGDTQVEMSFRKGERITLLRQVDENWYEGRIPGTSRQGIFPITYV
DVIKRPLVKNPVDYIDLPFSSSPSRSGTASPQFASHSKLIVPAPSSLPHPHRALSPEMHA
VTSEWISLTVGVPGRRPLALTPPLPPLPETSVYNTDPLSSWARPGSSLSLSLPHSSWSDR
SAPRSLAAPLALPPSHKAASLAPGAPTFLHVNGDSGVHMPPPGVHQDSFPQLLPGSSDRV
ISELSNAFSSQGKRQPRREERGQCERRAEREAGERYPGAPRISKKSCLRPSDVVRCLSAD
QRLSDLRAPEESRPGKPPGSPFPGREAEQTELHRGGEQAERKAARSAGSQPSHHSLRAGP
DLTESEKSYVQPQAQQRRVTPDRSQTSQDLFSYQALYSYIPQNDDELELRDGDIVDVMEK
CDDGWFVGTSRRTRQFGTFPGNYVKPLYL
Download sequence
Identical sequences M3Z097
ENSMPUP00000017008 ENSMPUP00000017008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]