SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z0D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z0D7
Domain Number 1 Region: 150-394
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9e-47
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily DEATH domain 3.24e-27
Family DEATH domain, DD 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Z0D7
Sequence length 580
Comment (tr|M3Z0D7|M3Z0D7_MUSPF) Interleukin 1 receptor associated kinase 2 {ECO:0000313|Ensembl:ENSMPUP00000017048} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=IRAK2 OC=Mustelinae; Mustela.
Sequence
MSCYIYQLPAWVLDDLCRNMDTLSEWDWMQFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLQLYRAAQIVLNWHGQTHGPSLSGHAPARANLPPPSADDP
HSLKTDFPVSSDSKGFSTSIPKQETLVSQAEDSLFWSEADVVQATENFNQNHKISEGTFA
DIYKGQRHGTPFVFKKLREVAYSGPGSVEKFFQAEVQICRRCCHPNVLPLLGFCTGNQLC
SLIYPYMANGSLQDRLQGQGGTDALLWPQRASICSGLLRAVGHLHSLEIIHGNVKSSNVL
LDQTFTPKLAHPMAHLCPDNKRSRYTMMKTHLFQASAAYLPEDFIRVGQLTKRVDIFSCG
IVLAEVLTGIPAMDNNRSPVYLKDLLLSEIPSSTTSLCCRKTDMEKVMAMEICQRYLEKR
AGRLPEDCAEALAMATCLCLRRRNASLAEVCGYVAIVDKRLRGQETLLPWSGLSEVTGSS
SNTPEETDDVDNSSLDASYSMRVAPRAGAAASLPSTEDGEGRLQVCGGAQADSSAASASL
EPSQDETSWKIEINEAKKKLMENIVFYKEGKLDSIELFGP
Download sequence
Identical sequences M3Z0D7
ENSMPUP00000017048 XP_004738574.1.14098 ENSMPUP00000017048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]