SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z0U9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z0U9
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.96e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000414
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.62e-26
Family Middle domain of MutM-like DNA repair proteins 0.0000023
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.13e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z0U9
Sequence length 344
Comment (tr|M3Z0U9|M3Z0U9_MUSPF) Nei like DNA glycosylase 1 {ECO:0000313|Ensembl:ENSMPUP00000017211} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NEIL1 OC=Mustelinae; Mustela.
Sequence
MPEGPELHLASLYVNEACKGLVFAGCVEKSPVSRNPEVPFESSAYCISSSARGKELRLTL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPRDALPAHAHLRFYTAPPGPPLALCFVDIRRF
GHWDLGGEWQPGRGPCVLLEYEQFRDNVLRNLADKVFDQPICEVLLDQRFFNGIGNYLRA
EILYRLKIPPFEKARKVLEELQQRRPSPELTLSQKIRAKLQNPDLLELCHSVPKEVVQLG
GKGYGPEHGEEDFAAFRAWLQCYGVPGMSSLRDRRGRTIWFQGDPGPLAPKGGKSRKKKS
KGAQQGLEHRLEVRLLPSFSPAPAAPPRSPPLTMGGKQWVLTNL
Download sequence
Identical sequences M3Z0U9
ENSMPUP00000017211 ENSMPUP00000017211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]