SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z0V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z0V1
Domain Number 1 Region: 36-195
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.63e-31
Family CRAL/TRIO domain 0.00048
Further Details:      
 
Domain Number 2 Region: 573-658
Classification Level Classification E-value
Superfamily PAH2 domain 2.88e-25
Family PAH2 domain 0.00000308
Further Details:      
 
Domain Number 3 Region: 395-464
Classification Level Classification E-value
Superfamily PAH2 domain 8.63e-24
Family PAH2 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 735-802
Classification Level Classification E-value
Superfamily PAH2 domain 0.00000000000000484
Family PAH2 domain 0.011
Further Details:      
 
Domain Number 5 Region: 200-262
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000184
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0077
Further Details:      
 
Weak hits

Sequence:  M3Z0V1
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00615
Family CRAL/TRIO N-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Z0V1
Sequence length 1550
Comment (tr|M3Z0V1|M3Z0V1_MUSPF) SIN3 transcription regulator family member A {ECO:0000313|Ensembl:ENSMPUP00000017213} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SIN3A OC=Mustelinae; Mustela.
Sequence
MARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIAL
FTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYTNFELDLGKKV
LNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECL
PENLDWDSVHVPGPHAMTIQELMDYVSTRQKRGIYEEYEDIRRENPVGTFHCSMSPGNLE
KNRYGDVPCLDQTRVKLTKRSGHTQVLWCIPEHERRMKRRLDDQESPVYAAQQRRIPGST
EAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAVPQSSGSHGPTIAAVHSS
HHHPAAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVY
NDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTT
PGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQ
QTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDI
YKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDAN
SSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPNQNGCQIRRHSGTGTTPPVKKKPK
LLSLKDSSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQL
VSPFLGKFPELFNWFKNFLGYKESVHLETFPKERATEGIAMEIDYASCKRLGSSYRALPK
SYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVL
ETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDG
LRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKV
LRSKSLLNEIESIYDERQEQATEDNAGIPVGPHLSLAYEDKQILEDAAALIIHHVKRQTG
IQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAAKKHNGVGGSPPK
SKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCSRLLRICSQAERQIEEENRE
REWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSL
REMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQTSR
SLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVE
RYMNSDTTSPELREHLARKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLD
KLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVP
REMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGAAFKAP
Download sequence
Identical sequences M3Z0V1
ENSMPUP00000017213 ENSMPUP00000017213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]