SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z0W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z0W6
Domain Number 1 Region: 342-400
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.28e-17
Family Erythroid transcription factor GATA-1 0.00015
Further Details:      
 
Domain Number 2 Region: 287-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.98e-16
Family Erythroid transcription factor GATA-1 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z0W6
Sequence length 480
Comment (tr|M3Z0W6|M3Z0W6_MUSPF) GATA binding protein 2 {ECO:0000313|EMBL:AER98939.1, ECO:0000313|Ensembl:ENSMPUP00000017228} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GATA2 OC=Mustelinae; Mustela.
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSAGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTDSMKMESGSPLRPGLAAMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSTKSKKNKKGAECFEELSKC
MQEKASPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Download sequence
Identical sequences M3Z0W6
ENSMPUP00000017228 XP_004738688.1.14098 XP_004738689.1.14098 ENSMPUP00000017228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]