SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Z1C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Z1C7
Domain Number 1 Region: 18-143
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-40
Family Phosphotyrosine-binding domain (PTB) 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Z1C7
Sequence length 517
Comment (tr|M3Z1C7|M3Z1C7_MUSPF) Fibroblast growth factor receptor substrate 2 {ECO:0000313|Ensembl:ENSMPUP00000017389} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FRS2 OC=Mustelinae; Mustela.
Sequence
MLTWSSEEAMGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRK
RDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSIN
VVEEPVVERNNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVG
SARLPSVGEESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARISNAESNTPKEE
PSRVEDRDPQILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANSTEWDTGYD
SDERRDAPSVNKLVYENINGLSIPSASGVRRGRLTSSSTSDTQNINNSAQRRTALLNYEN
LPSLPPVWEARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSR
RRDCTPTVFNFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELY
AVIDIERTAAMSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences M3Z1C7
ENSMPUP00000017389 ENSMPUP00000017389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]